Protein Info for IAI46_16405 in Serratia liquefaciens MT49

Annotation: phenylacetic acid degradation operon negative regulatory protein PaaX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF07848: PaaX" amino acids 20 to 88 (69 residues), 93.9 bits, see alignment E=8.7e-31 TIGR02277: phenylacetic acid degradation operon negative regulatory protein PaaX" amino acids 22 to 304 (283 residues), 336.4 bits, see alignment E=7.6e-105 PF20803: PaaX_M" amino acids 105 to 181 (77 residues), 48.1 bits, see alignment E=1.5e-16 PF08223: PaaX_C" amino acids 191 to 282 (92 residues), 93.1 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 60% identical to PAAX_ECOLI: Transcriptional repressor PaaX (paaX) from Escherichia coli (strain K12)

KEGG orthology group: K02616, phenylacetic acid degradation operon negative regulatory protein (inferred from 96% identity to spe:Spro_3083)

Predicted SEED Role

"Phenylacetic acid degradation operon negative regulatory protein PaaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>IAI46_16405 phenylacetic acid degradation operon negative regulatory protein PaaX (Serratia liquefaciens MT49)
MEHKLDEFIRHAIEAQPISGTSLIISLYGDALSHRGGEVWLGSLSALLEALGFGDRFVRT
SVFRLQKEGWLEVEKIGRRSFYRVTDQGMRQFRHAESKIYLSEPPAWDGKWDLLLLESAE
KEERARLKKELGWLGFGQIASNLMAAPTHAQTDVTALLGELNASEQVIYFRADYPYNRSE
KTLQQLVANCWALADVAADYHEFIVSFRPLMALLREADEALLTPQRCFQIKLLLIHFFRR
VVLKDPLLPDALLPAQWEGQIARNLCINIYQRVDRAATEYVSAMAETTIGALPAPAAGYY
RRFGGLPRDPTV