Protein Info for IAI46_16395 in Serratia liquefaciens MT49
Annotation: 3-oxoadipyl-CoA thiolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to PAAJ_ECOLX: Beta-ketoadipyl-CoA thiolase (paaJ) from Escherichia coli
KEGG orthology group: K02615, acetyl-CoA acetyltransferase [EC: 2.3.1.-] (inferred from 96% identity to spe:Spro_3081)MetaCyc: 76% identical to beta-ketoadipyl-CoA thiolase (Escherichia coli K-12 substr. MG1655)
RXN0-6512 [EC: 2.3.1.223]; 3-oxoadipyl-CoA thiolase. [EC: 2.3.1.223, 2.3.1.174]
Predicted SEED Role
"Acetyl-CoA acetyltransferase (EC 2.3.1.9); Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" (EC 2.3.1.-, EC 2.3.1.9)
MetaCyc Pathways
- oleate β-oxidation (29/35 steps found)
- 3-oxoadipate degradation (2/2 steps found)
- phenylacetate degradation I (aerobic) (7/9 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
- adipate biosynthesis (4/5 steps found)
- adipate degradation (4/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- pyruvate fermentation to hexanol (engineered) (8/11 steps found)
- superpathway of phenylethylamine degradation (8/11 steps found)
- ketolysis (2/3 steps found)
- polyhydroxybutanoate biosynthesis (2/3 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- acetoacetate degradation (to acetyl CoA) (1/2 steps found)
- aromatic compounds degradation via β-ketoadipate (6/9 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
- glycerol degradation to butanol (11/16 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
- pyruvate fermentation to butanoate (4/7 steps found)
- superpathway of salicylate degradation (4/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (3/6 steps found)
- valproate β-oxidation (5/9 steps found)
- isopropanol biosynthesis (engineered) (2/5 steps found)
- ketogenesis (2/5 steps found)
- pyruvate fermentation to acetone (2/5 steps found)
- 2-deoxy-D-ribose degradation II (4/8 steps found)
- pyruvate fermentation to butanol I (4/8 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (1/4 steps found)
- 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
- acetyl-CoA fermentation to butanoate (3/7 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- L-tryptophan degradation III (eukaryotic) (8/15 steps found)
- mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
- mevalonate pathway II (haloarchaea) (2/7 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- L-glutamate degradation VII (to butanoate) (5/12 steps found)
- 2-methylpropene degradation (2/8 steps found)
- isoprene biosynthesis II (engineered) (2/8 steps found)
- mevalonate pathway III (Thermoplasma) (2/8 steps found)
- mevalonate pathway IV (archaea) (2/8 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
- L-lysine fermentation to acetate and butanoate (3/10 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- 4-oxopentanoate degradation (1/9 steps found)
- mandelate degradation to acetyl-CoA (7/18 steps found)
- ethylmalonyl-CoA pathway (1/11 steps found)
- superpathway of aerobic toluene degradation (14/30 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
- toluene degradation VI (anaerobic) (3/18 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
- superpathway of ergosterol biosynthesis I (4/26 steps found)
- superpathway of L-lysine degradation (13/43 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
- superpathway of cholesterol biosynthesis (4/38 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Fatty acid metabolism
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Propanoate metabolism
- Pyruvate metabolism
- Synthesis and degradation of ketone bodies
- Terpenoid biosynthesis
- Tryptophan metabolism
- Tyrosine metabolism
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.174, 2.3.1.9
Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.223 or 2.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (401 amino acids)
>IAI46_16395 3-oxoadipyl-CoA thiolase (Serratia liquefaciens MT49) MNQAFICDGVRTPIGRYGGALANVRADDLAALPLRALLARHSQVDWSRVDDVILGCANQA GEDNRNLARMAALLAGLPVNVSGTTLNRLCGSGLDALATAARSIKAGEAGLVLAGGAESM TRAPLVMGKADSAFSRQTQLYDTTLGWRFINPLMQAQYGTESMPETAENVAEKFNVSRAD QDAFALRSQQRAARAQALGIFAQEIVPVSLSGKKGAVTLFDQDEHPRADTRLEQLQALKT PFRQPGTVTAGNASGLNDGAAALIVASEAMAVSQGLTPRARIVATATCGVEPGLMGIGPL PATRKVLELAGLSLAQMDVIELNEAFAAQALAVLRQLGLPDDAPQVNPNGGAIALGHPLG MSGARLALAALFELERRSGRYALCTMCIGVGQGIAMIIERV