Protein Info for IAI46_16390 in Serratia liquefaciens MT49

Annotation: hydroxyphenylacetyl-CoA thioesterase PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 22 to 135 (114 residues), 114 bits, E=4.3e-37
• TIGR02286: phenylacetic acid degradation protein PaaD
  • amino acids 25 to 137 (113 residues), 157 bits, E=2e-50
• PF13622: 4HBT_3
  • amino acids 52 to 122 (71 residues), 25.4 bits, E=1.3e-09
• PF03061: 4HBT
  • amino acids 53 to 127 (75 residues), 69.7 bits, E=2.2e-23

Best Hits

Swiss-Prot: 70% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 97% identity to spe:Spro_3080)

MetaCyc: 70% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Protein Sequence (146 amino acids)

>IAI46_16390 hydroxyphenylacetyl-CoA thioesterase PaaI (Serratia liquefaciens MT49)
MNANTPHALAQRCAEQMFQQDTCAQAMGMRVDAVDAGFAKVSMTVGPQMLNGHQTCHGGQ
LFSLADTAFAYACNSQGLAAVASGCSIDFIRPALAGDRLTASAEVRHQGKTTGLYDVEIV
NQLGKTVAWFRGRAHRLGHAILGEQA