Protein Info for IAI46_16350 in Serratia liquefaciens MT49

Annotation: 1,2-phenylacetyl-CoA epoxidase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02156: phenylacetate-CoA oxygenase, PaaG subunit
  • amino acids 11 to 298 (288 residues), 507.9 bits, E=3.5e-157
• PF05138: PaaA_PaaC
  • amino acids 21 to 295 (275 residues), 316.9 bits, E=4.6e-99

Best Hits

Swiss-Prot: 79% identical to PAAA_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit A (paaA) from Escherichia coli (strain K12)

KEGG orthology group: K02609, phenylacetic acid degradation protein (inferred from 97% identity to spe:Spro_3072)

MetaCyc: 79% identical to phenylacetyl-CoA 1,2-epoxidase, monooxygenase subunit (Escherichia coli K-12 substr. MG1655)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaG subunit"

MetaCyc Pathways

• phenylacetate degradation I (aerobic) (7/9 steps found)
• superpathway of phenylethylamine degradation (8/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Protein Sequence (312 amino acids)

>IAI46_16350 1,2-phenylacetyl-CoA epoxidase subunit A (Serratia liquefaciens MT49)
MTTDAQHQQHFDDKIAADTSIEAKDWMPDAYRQNLIRQIGQHAHSEVVGMLPEANWLTRA
PTLRRKAVLLAKVQDEAGHGLYLYSAAETLGCSRQDIYQKMLDGKMKYSSIFNYPTLNWA
DIGVIGWLVDGAAIVNQVALCRASYGPYARAMVKICKEESFHQRQGYEAVMAMANGSEQQ
KAMLQDAINRFWWPVLMMFGPSDTDSPHSAQSMAWKIKRHSNDELRQKFVDNTVPQLEAL
GMVAPDADLAWDEATGHYRFGEIDWSELHEVIKGRGQCNHERLQAKRRAWEDGAWVRDGA
LAHASKNTSTAA