Protein Info for IAI46_16265 in Serratia liquefaciens MT49

Annotation: ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details PF00520: Ion_trans" amino acids 30 to 249 (220 residues), 113.4 bits, see alignment E=1.1e-36 PF07885: Ion_trans_2" amino acids 167 to 244 (78 residues), 62.1 bits, see alignment E=3.8e-21

Best Hits

KEGG orthology group: None (inferred from 91% identity to spe:Spro_3053)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>IAI46_16265 ion transporter (Serratia liquefaciens MT49)
MTTDTAALSLRQRSYRLLFDNHSRIGRRMETFWVATALLSVILLFLEPGGSALYAPGRQA
IYLFFWAEVVFTFIFTLEYLLRLWSTPREQHYALSFFGMVDLLTVLPLYIIWLFPHMTVE
FVMLLRVLRILRVLRVLKLLRYMSEMGMIWRSIKLARHKLAMFFGFVAVVLCVFGGLMYA
IEGGSGGFTSLAASIYWAVVTLTTVGYGDIVPHTPLGRLLTSVLILVGYSIIAVPTGILT
AYMSQELQRSRERRNCEQCQRGGHETEAIFCKYCGSRLPPLSGKQSQK