Protein Info for IAI46_16260 in Serratia liquefaciens MT49

Annotation: transcription antiterminator/RNA stability regulator CspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00313: CSD
  • amino acids 6 to 69 (64 residues), 112.8 bits, E=2.8e-37

Best Hits

Swiss-Prot: 86% identical to CSPC_ECOL6: Cold shock-like protein CspC (cspC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 99% identity to ypa:YPA_1865)

Predicted SEED Role

"Cold shock protein CspA"

Protein Sequence (70 amino acids)

>IAI46_16260 transcription antiterminator/RNA stability regulator CspE (Serratia liquefaciens MT49)
MSNMIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQDQGFKTLAEGQNVQFSIENGAK
GPSAANVTAI