Protein Info for IAI46_16250 in Serratia liquefaciens MT49

Annotation: transcriptional regulator RcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00196: GerE" amino acids 139 to 193 (55 residues), 62.6 bits, see alignment E=1e-21

Best Hits

Swiss-Prot: 69% identical to RCSA_PANSE: Transcriptional regulatory protein RcsA (rcsA) from Pantoea stewartii subsp. stewartii

KEGG orthology group: K07781, LuxR family transcriptional regulator, capsular biosynthesis positive transcription factor (inferred from 99% identity to srs:SerAS12_3125)

Predicted SEED Role

"Colanic acid capsular biosynthesis activation accesory protein RcsA, co-regulator with RcsB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>IAI46_16250 transcriptional regulator RcsA (Serratia liquefaciens MT49)
MPTIIMDSCSYTRLGLTDYLTTHGVKKRQINAINDIDDLHEKCSKLKPSLVFINEDCFIH
EANATERIKGVISLHPDTLFFIFMAITNVHFDDYLYVRKNVIISSKSIKPETMNQLLSHY
LEKKAPRTEKTSFDQTPVTLSQTESNMLRMWMSGQGTIQISDQMQIKAKTVSSHKGNIKR
KIKTHNKQIIYHVVRLTDTLTSGIFVNSR