Protein Info for IAI46_16225 in Serratia liquefaciens MT49

Annotation: MgtC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 92 to 102 (11 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details PF02308: MgtC" amino acids 10 to 129 (120 residues), 136.8 bits, see alignment E=4.7e-44 PF21770: MgtC_SapB_C" amino acids 147 to 224 (78 residues), 85.3 bits, see alignment E=3.5e-28

Best Hits

Swiss-Prot: 61% identical to MGTC_SALTI: Protein MgtC (mgtC) from Salmonella typhi

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 98% identity to srs:SerAS12_3120)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>IAI46_16225 MgtC family protein (Serratia liquefaciens MT49)
MAMTPFVLNLLLAMSLGAVIGAERQWRQRMAGLRTNALVATGAAVFILSSMSTDPSSAGR
VAAQIVSGIGFLGAGVIMREGLNIRGLNTAATLWCSAAIGVLCGLGQYWNAVLATLVILC
ANILLREAAQRINLQPQQQATDLEVCYRIQVTCGEQDEILVRTLILQALNGVALRLQSLR
SADIAIPGQLEVCAEITANPSVQKEIEGIVCRVSLEKSVSAVRWRIASELPV