Protein Info for IAI46_16120 in Serratia liquefaciens MT49

Annotation: aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF00155: Aminotran_1_2" amino acids 205 to 400 (196 residues), 46.1 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 91% identity to spe:Spro_3028)

Predicted SEED Role

"2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29)" in subsystem Glycine Biosynthesis or Glycine and Serine Utilization (EC 2.3.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.29

Use Curated BLAST to search for 2.3.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>IAI46_16120 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme (Serratia liquefaciens MT49)
MSSRKQIIPTNKFRNNDKAIGIGNPFWDMSEQNGLAGIVAGLDNDLLSTQSGHQFVNFSC
CSYLNLDSHSKVVEGAIDAVRRYGVLDHCIARSRVQLPAMKELEASLGELFQADVLSGVS
ASSVSGGLLPLIASGHLGNGVRPLMIFDKHAHVSLAAAKPACADETEVVTCNYHDLNFIE
DCCKQYQRVCYVVDGSDSLGGYAPVKALAELQDKYGLMVFYDDSHSISAYGERGVGYVRS
HSPALDENTIMVVTLNKAFGTSGAAILLNGYSQQMLRLVERFGGGLNYSQNLNTAAIGAS
LASAEIHRTAELPRLQKKLYDNIALFDSLIPTEQSGNTYPIRLVPMSDDRVIEAGRQVIE
AGFYVSPVFFPIVAKGTAGLRVMMRAGQTQEQIRGLCQVISAVRGPQ