Protein Info for IAI46_16110 in Serratia liquefaciens MT49

Annotation: acetaldehyde dehydrogenase (acetylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR03215: acetaldehyde dehydrogenase (acetylating)" amino acids 3 to 283 (281 residues), 288.5 bits, see alignment E=2.7e-90 PF01118: Semialdhyde_dh" amino acids 5 to 100 (96 residues), 33 bits, see alignment E=7.3e-12 PF09290: AcetDehyd-dimer" amino acids 125 to 260 (136 residues), 131.6 bits, see alignment E=2.4e-42

Best Hits

Swiss-Prot: 59% identical to ACDH_STRGG: Acetaldehyde dehydrogenase (SGR_565) from Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 86% identity to spe:Spro_3026)

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.10

Use Curated BLAST to search for 1.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>IAI46_16110 acetaldehyde dehydrogenase (acetylating) (Serratia liquefaciens MT49)
MTLSVAVIGTGAIGMDLVNKIQRSPLLHCGLLAGRNKDSAGLEVAARLGCPTSAGGIDAV
LASPTPFDVVFDATNAMSHAKHWELLRPLGSLMIDLTPSHLGKMIVPTVTGTEALTERNV
SLISCGGQASIPILHALSRHFRIIDIEVVATVASNILGRATRINIDEYVDTTQRALSAFT
GVANTKAILNISPAAPPAMFRVTIFAGIPGVTKEQITPVLAEAVEAVRGFSAGYSLTALN
VSEGRVSISLEVVASSKVMPEYAGNLDLINSAAILVAEQYASYRNKTEGANGHAD