Protein Info for IAI46_16090 in Serratia liquefaciens MT49

Annotation: tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF03301: Trp_dioxygenase" amino acids 11 to 141 (131 residues), 142.8 bits, see alignment E=8.7e-46 amino acids 205 to 276 (72 residues), 76.2 bits, see alignment E=1.6e-25 TIGR03036: tryptophan 2,3-dioxygenase" amino acids 13 to 278 (266 residues), 409.5 bits, see alignment E=2.9e-127

Best Hits

Swiss-Prot: 99% identical to T23O_SERP5: Tryptophan 2,3-dioxygenase (kynA) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_3084)

MetaCyc: 38% identical to tryptophan 2,3-dioxygenase (Streptosporangium sibiricum)
Tryptophan 2,3-dioxygenase. [EC: 1.13.11.11, 1.13.11.52]

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11 or 1.13.11.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>IAI46_16090 tryptophan 2,3-dioxygenase (Serratia liquefaciens MT49)
MNKRELESAIVTDFSKRMSYGDYLCLDQLLDCQHPLSNPQHHDEMLFVVQHQTSELWMKL
MLHELQAARMLVQQDKLSHCFKILARVKQIQRLLFEQWAVLETLTPSEYVEFRDVLGSSS
GFQSHQYRSIEFLLGNKNAAMLAVFSNDAEKHAALKAILEAPSLYDEYLLYLSRHGLPIP
QECIERDWTQPYQRNPNLLPAFKEIYDHPQKYWEAYEMAEKLVDIEESFHLWRFRHMKTV
ERIIGFKTGTGGSSGVSFLKKALELTFFPELLDVRTEIGA