Protein Info for IAI46_16075 in Serratia liquefaciens MT49

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF16884: ADH_N_2" amino acids 9 to 115 (107 residues), 146.9 bits, see alignment E=2.9e-47 PF00107: ADH_zinc_N" amino acids 161 to 296 (136 residues), 72.9 bits, see alignment E=3.7e-24 PF13602: ADH_zinc_N_2" amino acids 194 to 339 (146 residues), 52.6 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 70% identical to CURA_ECOLI: NADPH-dependent curcumin reductase (curA) from Escherichia coli (strain K12)

KEGG orthology group: K07119, (no description) (inferred from 94% identity to spe:Spro_2992)

MetaCyc: 70% identical to NADPH-dependent curcumin/dihydrocurcumin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6676; RXN0-6677

Predicted SEED Role

"Putative oxidoreductase YncB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>IAI46_16075 NADP-dependent oxidoreductase (Serratia liquefaciens MT49)
MSQSTQQNRRFLLASRPHGEPVADNFRLETVATPQPAAGQVLLRTVYLSLDPYMRGRMSD
APSYAPPVQIGETMVGGTVSRVVTSQHPDFKPGDWVLGYDGWQDYALSDGSGLRNLGPHQ
AHPSRLLGVLGMPGFTAYMGLLEIGQPKPGETLVVAAASGAVGSVVGQVAKLKGCRVVGV
AGGKEKCRYVVEELGFDACVDHRAPDFAEQLAAACPQGIDIYYENVGGAVFDAVIPLLNT
QARIPVCGIIAHYNATDLPAGPDRLPMLQGLILRKRIRMQGFIIFDDFAEGFDKFLQQMS
EWVDQGKIKFREDLVDGLENAPQAFIGLLQGKNFGKLVIRVADE