Protein Info for IAI46_16025 in Serratia liquefaciens MT49

Annotation: Tar ligand binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 188 to 210 (23 residues), see Phobius details PF02203: TarH" amino acids 1 to 176 (176 residues), 173.5 bits, see alignment E=6.3e-55 PF00672: HAMP" amino acids 209 to 259 (51 residues), 48.4 bits, see alignment 1.4e-16 PF00015: MCPsignal" amino acids 323 to 480 (158 residues), 192.9 bits, see alignment E=6.3e-61

Best Hits

Swiss-Prot: 87% identical to MCPD_KLEAK: Methyl-accepting chemotaxis aspartate transducer (tas) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: K05877, methyl-accepting chemotaxis protein IV, peptide sensor receptor (inferred from 97% identity to spe:Spro_2982)

Predicted SEED Role

"Methyl-accepting chemotaxis protein IV (dipeptide chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>IAI46_16025 Tar ligand binding domain-containing protein (Serratia liquefaciens MT49)
MFNRIRVSTSLFLLLMTFCVMQLATSGLSYTAFRSDNHNLNLITLGSQQRDALSLSWVSL
LQARNTLNRAGTRAALKLPQDQVNALMGNARSSLQKADLYFNQFLAVPRNSEQEQQLTET
TKASYDRLRSALRELIGFLENDRLQAFMDQPTQKTQDLFEADFVQYLQLVNANVSEANAA
NQQSFTLSGWLVAGAVLMLLVVTGSAMWWLRNMLVQPLNIMRSHFDRIAAGDLATPIQVY
GRNEISQLFASLQRMQQSLIGTVGAVRDGAESILIGLQEISEGNNDLSSRTEQQAASLEE
TAASMEQLTATVKQNADNARQASQLARDASTTAAKGGELAGDVVTTMHDIANSSQKIGAI
TSVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKGLIDES
VSRVKQGSVLVENSGATMQDIVRSVTRVTDIMGEIASASDEQSRGIEQVTQAVTQMDQVT
QQNAALVEEAASAATALEDQAITLADAVSVFRLADDNFTAQANHQDAVSPVVKEAPDCQT
A