Protein Info for IAI46_16000 in Serratia liquefaciens MT49

Annotation: flagellar type III secretion system protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 90 to 117 (28 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 186 to 213 (28 residues), see Phobius details PF01312: Bac_export_2" amino acids 8 to 347 (340 residues), 433.6 bits, see alignment E=2.7e-134 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 354 (347 residues), 439.3 bits, see alignment E=5.5e-136

Best Hits

Swiss-Prot: 78% identical to FLHB_YEREN: Flagellar biosynthetic protein FlhB (flhB) from Yersinia enterocolitica

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 94% identity to spe:Spro_2977)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>IAI46_16000 flagellar type III secretion system protein FlhB (Serratia liquefaciens MT49)
MAEDSDLEKSEAPTPHRVEKAREDGQIPRSRELTSVLMLVAGLSIIWVSGGNMAQQLAAM
LTQGLNFDHGMVSNDKQMLRQLAMLLRQAVWALLPIMAGLALVALTAPMLLGGLLLSGKS
LKFDLKRMNPLSGLKRIFSSQVLAELLKGILKATLVGWITGLYLWHNWAAMLHLVTQQPL
DALGNALRMIIFCGLLVVLGLTPMVAFDVFYQLWSHFKKLKMTKQDIRDEFKEQEGDPHV
KGRIRQQQRAVARRRMMADVPKADVIVTNPTHYAVALQYNDKNMSAPKVLAKGAGEIALR
IRELGAEHRIPMLEAPPLARALYRHSEIGQHIPATLYAAVAEVLAWVYQLRRWRREGGLI
PKKPERLPVPEALDFAGESNTNG