Protein Info for IAI46_15965 in Serratia liquefaciens MT49

Annotation: flagellar basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17656: ChapFlgA_N
  • amino acids 24 to 91 (68 residues), 32.9 bits, E=1e-11
• TIGR03170: flagella basal body P-ring formation protein FlgA
  • amino acids 82 to 215 (134 residues), 131.9 bits, E=7.7e-43
• PF13144: ChapFlgA
  • amino acids 94 to 215 (122 residues), 104.4 bits, E=6.4e-34
• PF08666: SAF
  • amino acids 94 to 155 (62 residues), 50.9 bits, E=2.9e-17

Best Hits

Swiss-Prot: 60% identical to FLGA_YEREN: Flagella basal body P-ring formation protein FlgA (flgA) from Yersinia enterocolitica

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 85% identity to spe:Spro_2971)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Protein Sequence (217 amino acids)

>IAI46_15965 flagellar basal body P-ring formation protein FlgA (Serratia liquefaciens MT49)
MKAKMLLLAALLCSLNARAEDLAAQIDRFISSQFSGSPVQVKVLVRTPATQWPQCEFPQL
SLPQNARRWGNISVSARCGQERRFIQTQVQVIGQYLVSARGISAGSKLTAADITFKSGRL
DTLPPRTLSETGKALGAVSLRNISPGQPLTFAMLRRAWVIKAGQAVQVTAQGSGFNISGT
GKAMNNAAAEDNVRVRMASGQIVSGIASDDGTIRIGL