Protein Info for IAI46_15925 in Serratia liquefaciens MT49

Annotation: flagellar basal body P-ring protein FlgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02119: FlgI" amino acids 22 to 365 (344 residues), 459 bits, see alignment E=4.5e-142

Best Hits

Swiss-Prot: 88% identical to FLGI_YERPY: Flagellar P-ring protein (flgI) from Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_3050)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>IAI46_15925 flagellar basal body P-ring protein FlgI (Serratia liquefaciens MT49)
MLKKFLMALVISALSLPAAAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTT
QSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFSRTGQNIDVVVSSMGNAKSLRGG
TLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGATIERELPTTF
GAGGVINLQLNDEDFTLAQQISDAINRQRGGGTASPLDARTIQVLVPQGNSSQVRFLAEI
QNINVSVGAIDAKVIINSRTGSVVMNRDVILDSCAVAQGNLSVVVDRQNTVSQPNTPFGG
GQTVVTPNTQISVQQQGGSLQKVNASANLNNVIRALNALGATPIDLMSILQAMQSAGCLR
AKLEII