Protein Info for IAI46_15920 in Serratia liquefaciens MT49

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02541: flagellar rod assembly protein/muramidase FlgJ
  • amino acids 12 to 295 (284 residues), 372.3 bits, E=1.3e-115
• PF10135: Rod-binding
  • amino acids 50 to 96 (47 residues), 60.9 bits, 1.3e-20
• PF01832: Glucosaminidase
  • amino acids 160 to 295 (136 residues), 124.5 bits, E=4.2e-40

Best Hits

Swiss-Prot: 62% identical to FLGJ_SALTY: Peptidoglycan hydrolase FlgJ (flgJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 93% identity to srs:SerAS12_3050)

MetaCyc: 62% identical to flagellar rod assembly protein/beta-N-acetylglucosaminidase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Beta-N-acetylhexosaminidase. [EC: 3.2.1.52]

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

MetaCyc Pathways

• peptidoglycan recycling I (13/14 steps found)
• chitin degradation III (Serratia) (7/7 steps found)
• chitin degradation II (Vibrio) (4/6 steps found)
• peptidoglycan recycling II (6/10 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Nucleotide sugars metabolism
• Other glycan degradation
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-, 3.2.1.52

Use Curated BLAST to search for 3.2.1.- or 3.2.1.52

Protein Sequence (313 amino acids)

>IAI46_15920 flagellar assembly peptidoglycan hydrolase FlgJ (Serratia liquefaciens MT49)
MAGDLMAMSGAAYDAQALNGLKRDAASDPQGNLKQVAQQVEGMFVQMMLKSMRAALPQDG
ILSSDQSRLYTSMYDQQIAQQMSQKGLGLADMMVKQMSNANAVPSETAGMSPMALDDEVL
RTLPNQALEQTLRRAVPKAPSTAPLSLNNGNFVARLSTPARVVSQQSGIPHQLIVAQAAL
ESGWGQREIPAADGSPSYNLFGIKAGGSWDGPVTEITTTEFEQGAAKKIKAKFRVYGSYV
EAMADYVKLLTNNPRYAGVANARSPEQAAQALQQAGYATDPQYASKLVSVIQQMKNAGEQ
VVKAYTHDLKDLF