Protein Info for IAI46_15910 in Serratia liquefaciens MT49

Annotation: flagellar hook-associated protein FlgL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02550: flagellar hook-associated protein 3
  • amino acids 2 to 195 (194 residues), 217.5 bits, E=1.9e-68
• PF00669: Flagellin_N
  • amino acids 3 to 137 (135 residues), 89.8 bits, E=8.6e-30

Best Hits

Swiss-Prot: 61% identical to FLGL_SALTY: Flagellar hook-associated protein 3 (flgL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02397, flagellar hook-associated protein 3 FlgL (inferred from 93% identity to spe:Spro_2960)

Predicted SEED Role

"Flagellar hook-associated protein FlgL" in subsystem Flagellum

Protein Sequence (319 amino acids)

>IAI46_15910 flagellar hook-associated protein FlgL (Serratia liquefaciens MT49)
MRMSTSMMYQQNMSGITGNQSLFMKAAEQLSTGKKVSNPSDDPLAASQAVMLAQSQSENT
QYALARTFARQSVSMEETVLAGVTSTISDMKALIVSAGGTKSDDDRDSLATQLQGLKDQL
LNQANSTDGNGRYMFGGFVNDKPPFEDKGGSVSYVGGNTPVEQKVDANRTMTIGHTGDKV
FMALTSNPKPEPDGSASVANVFESIDIALKALKTPQKDADDATKQQVNDALAKANRGLDN
SYNRVLSVRAELGSQLQEMDTLDSIGKDRDMINKTQMSALVDADLAESISSYFMQQAALQ
ASYKTFGDMQGMSLFQLNR