Protein Info for IAI46_15900 in Serratia liquefaciens MT49

Annotation: flagellar type III secretion system protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 45 to 69 (25 residues), see Phobius details amino acids 71 to 72 (2 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 14 to 254 (241 residues), 245.8 bits, see alignment E=2.5e-77 PF01311: Bac_export_1" amino acids 14 to 246 (233 residues), 223 bits, see alignment E=2.1e-70

Best Hits

Swiss-Prot: 68% identical to FLIR_ECOLI: Flagellar biosynthetic protein FliR (fliR) from Escherichia coli (strain K12)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 99% identity to spe:Spro_2959)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>IAI46_15900 flagellar type III secretion system protein FliR (Serratia liquefaciens MT49)
MLTFDSAQFGVWLSQYFWPLLRILALISTAPVFSEKQISKKVKIGLGGLIVILIAPGLPT
STVPIFSAAGLWLAAQQILIGVALGLTMQFAFAAIRLAGEVIGMQMGLSFATFFDPSGGP
NMPVLARLLNLLAMLLFLSFNGHLWLISLLVDSFHTLPIQAEPLNGNGFLALTQAGSLIF
INGMMLALPLICLLLTLNMALGLLNRMTPQLSVFVIGFPVTMTIGIMTIGMMMPMLAPFC
EHLFGEFFDRLADVVGSMTP