Protein Info for IAI46_15890 in Serratia liquefaciens MT49

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 70 (30 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 43 to 239 (197 residues), 309.3 bits, see alignment E=5.5e-97 PF00813: FliP" amino acids 43 to 235 (193 residues), 273 bits, see alignment E=7.9e-86

Best Hits

Swiss-Prot: 86% identical to FLIP_SALTY: Flagellar biosynthetic protein FliP (fliP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 98% identity to srs:SerAS12_3042)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>IAI46_15890 flagellar type III secretion system pore protein FliP (Serratia liquefaciens MT49)
MRVLAATLLLLSPTAFAQLPGLISQPLANGGQSWSLPVQTLVLLTSLSFLPAMLLMMTSF
TRIIIVLGLLRNALGTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISLD
IALDKGSQPLREFMLRQTRETDLALYAKLANQPPLAGPEAVPMRILLPAYVTSELKTAFQ
IGFTVFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSFY
S