Protein Info for IAI46_15855 in Serratia liquefaciens MT49

Annotation: flagellum-specific ATP synthase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR01026: ATPase, FliI/YscN family" amino acids 7 to 452 (446 residues), 632.2 bits, see alignment E=4.2e-194 TIGR03496: flagellar protein export ATPase FliI" amino acids 29 to 451 (423 residues), 653.7 bits, see alignment E=1.1e-200 PF00006: ATP-synt_ab" amino acids 161 to 372 (212 residues), 288.8 bits, see alignment E=2.6e-90 PF18269: T3SS_ATPase_C" amino acids 380 to 450 (71 residues), 87.6 bits, see alignment E=4e-29

Best Hits

Swiss-Prot: 84% identical to FLII_ECOLI: Flagellum-specific ATP synthase (fliI) from Escherichia coli (strain K12)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 98% identity to spe:Spro_2950)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>IAI46_15855 flagellum-specific ATP synthase FliI (Serratia liquefaciens MT49)
MTLRLGRWLTSLDALEKRIAHAPTVRRYGRLTRATGLVLEATGLQLPIGATCLIERHDAG
EVQEVESEVVGFNGQRLFLMPLEEVEGIVPGARVYARISPEGQSASKQLPLGPALLGRVL
DGSAKPLDGLPAPETGYRAPLITAPFNPLQRTPIEQVLDVGVRTINGLLTVGRGQRMGLF
AGSGVGKSVLLGMMARYTQADVIVVGLIGERGREVKDFIENILGPEGRARSVVIAAPADV
SPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSV
FAKLPALVERAGNGISGGGSITAFYTVLTEGDDQQDPIADSARAILDGHVVLSRRLAEAG
HYPAIDIEASISRAMTSLIDEEHYRRVRNFKQMLASYQRNRDLISVGAYVAGSDPLLDKA
MTLYPQMEAYLQQGIFERSGYQDACQQLQQLIV