Protein Info for IAI46_15835 in Serratia liquefaciens MT49

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 2 to 103 (102 residues), 99.8 bits, E=5.9e-33
• PF02049: FliE
  • amino acids 18 to 104 (87 residues), 100.7 bits, E=2.1e-33

Best Hits

Swiss-Prot: 90% identical to FLIE_SERP5: Flagellar hook-basal body complex protein FliE (fliE) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 90% identity to spe:Spro_2946)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (104 amino acids)

>IAI46_15835 flagellar hook-basal body complex protein FliE (Serratia liquefaciens MT49)
MAIQGIEGVLQQLQATAIQAGQMGQGASAQGVSFASELKAAIGKISDTQQAARKQAQDFE
VGAPGISLNDVMVDLQKSSISLQLGVQVRNKLVSAYQEVMNMPV