Protein Info for IAI46_15705 in Serratia liquefaciens MT49

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF13247: Fer4_11" amino acids 50 to 144 (95 residues), 94.7 bits, see alignment E=1.3e-30 PF13237: Fer4_10" amino acids 55 to 100 (46 residues), 24.7 bits, see alignment E=7.8e-09 PF12797: Fer4_2" amino acids 81 to 101 (21 residues), 25.8 bits, see alignment (E = 2.8e-09) PF00037: Fer4" amino acids 83 to 104 (22 residues), 31.6 bits, see alignment (E = 4e-11) PF12837: Fer4_6" amino acids 85 to 104 (20 residues), 29.3 bits, see alignment (E = 2.3e-10) PF12800: Fer4_4" amino acids 87 to 102 (16 residues), 22.5 bits, see alignment (E = 4.1e-08)

Best Hits

KEGG orthology group: None (inferred from 93% identity to spe:Spro_2923)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.99.-)" in subsystem Anaerobic respiratory reductases (EC 1.8.99.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>IAI46_15705 4Fe-4S dicluster domain-containing protein (Serratia liquefaciens MT49)
MVRQYGFLVDMRGCYGCKTCSMACKSENATPAGVLWRRVREFHFDAPNAMAFISMSCNHC
DDPQCMKVCPADTYSKRPDGIVVQDHDKCIGCRMCIMACPYNAPVFDPVEGKTSKCNLCA
ERLDEGLLPRCVASCPAGVLQFGDIDELRARHSADLARIETRYSLPDHRISQPNIVIIPA
GDKE