Protein Info for IAI46_15645 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 129 to 157 (29 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details PF12911: OppC_N" amino acids 29 to 64 (36 residues), 28.4 bits, see alignment 1.2e-10 PF00528: BPD_transp_1" amino acids 105 to 286 (182 residues), 110.7 bits, see alignment E=7.5e-36

Best Hits

Swiss-Prot: 44% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 96% identity to spe:Spro_2914)

MetaCyc: 45% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>IAI46_15645 ABC transporter permease (Serratia liquefaciens MT49)
MSQYLSEHEPQSEPAVGYRQRGKLTTLTLGATLVAVLILTALLAPWLAPFDPNLQHIELR
LLPPSSGHWLGTDGFGRDLLSRVIYGARPTLILVSLILLLTIPIGLLVGISAGYLGGWVE
RILMRVTDIFLSLPSLVIALAFVAVLGPGLMNGALALALTSWPAFARQARAETLALRRSD
YLAAARMQGIGGLRLMAGHILPLCLPSAVVRAALSLGGIILSAAGLGFLGMGVAPPTAEW
GSMVAEGSKVIFDQWWVAAAPGGAILFASLAFNLLGDGLRDKMDPRHGH