Protein Info for IAI46_15570 in Serratia liquefaciens MT49

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 6 to 253 (248 residues), 79.8 bits, see alignment E=3.7e-26 PF13440: Polysacc_synt_3" amino acids 29 to 321 (293 residues), 62.9 bits, see alignment E=4.5e-21 PF14667: Polysacc_synt_C" amino acids 324 to 402 (79 residues), 43.5 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_2892)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>IAI46_15570 flippase (Serratia liquefaciens MT49)
MKAMLMNSLWLMLERVSLSLSGIFVSVYVARYLGPAQYGLINYLLSVIAIAVPLVQLGAD
AVLFNRVARQRQSGIRLMLASMRLRRQLFALIALPLMAWALLTQDRTSQIMMALMLVSAY
FSVQDVYKIYYDALLKSKLNTLINNVALLLSIVVRLALVHAKLPLEWFAVPYVLSSLIPY
GVRWLLFRREKGGMRPISLRHQRRYGRYLLKVGLPLAVSGLSIVIYTRIDQIMIGNYLGE
HSVGLYSAAITLSQGWVFVPIALITSMMPGVANAGSLSEQEGRIRLLYLVVLLLSMPVIL
LLSLFPGPIVKLMFGDSYRETATILALCSVTSLFSVMGTVSYRAIVLFGGYRFIAIKMPL
AALVNVLMNLVLIPRYGILGAAISTLITEFISFFVLNGFFRKGQITRLQVTCYRCLPQLI
GKVRELYAK