Protein Info for IAI46_15555 in Serratia liquefaciens MT49

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 81 to 100 (20 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 17 to 163 (147 residues), 36.3 bits, see alignment E=1.9e-12 PF13439: Glyco_transf_4" amino acids 17 to 163 (147 residues), 42 bits, see alignment E=2.7e-14 PF20706: GT4-conflict" amino acids 169 to 295 (127 residues), 45.6 bits, see alignment E=1.3e-15 PF00534: Glycos_transf_1" amino acids 175 to 327 (153 residues), 134.3 bits, see alignment E=8.4e-43 PF13692: Glyco_trans_1_4" amino acids 179 to 319 (141 residues), 118.2 bits, see alignment E=8.6e-38

Best Hits

KEGG orthology group: None (inferred from 91% identity to spe:Spro_2889)

Predicted SEED Role

"Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.52)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.52

Use Curated BLAST to search for 2.4.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>IAI46_15555 glycosyltransferase family 4 protein (Serratia liquefaciens MT49)
MQQRKVAIVIENIAEKGGTERVASSLANALTTRLGHQVDLVSISGDRAFYPLEESVSLRF
MPGRTLLWPWRLAWFLRRGRYDVIITVSMGKLSSIMVPYLRLLCPHSRLLLSEHVSFHQY
AWPMKWLKVLVYRLGDRTVLLTKKDLATISRWVPGRKCRVIENVSPFPVQPPQPAQQQPV
ALAVGRLCRQKGFDRLIAAWQRIAPQAPGWQLHIVGDGPDRETLQQQIDAAGLGGQVKLL
PATADIAGHYRQAAMLLMTSRYEGLPMVLIEAMSFGLPLVAFDCQTGPAELIDDGKNGYL
VPEGDIEAFSQRTLALIGDGELRQRFSLHSLARAQQYIPERIYPQWQQLIAGG