Protein Info for IAI46_15390 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details PF12911: OppC_N" amino acids 28 to 79 (52 residues), 58.3 bits, see alignment 5.4e-20 PF00528: BPD_transp_1" amino acids 120 to 312 (193 residues), 109.9 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 96% identity to srs:SerAS12_2946)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>IAI46_15390 ABC transporter permease (Serratia liquefaciens MT49)
MLASLFFGRRRRWRQAQLPSLAQLSPPPTAQAWQRLRRHRLAMISLLLLVLMAVLCLFGP
MLSPWQDDAGDALNINQAPGAQHWLGTDFLGRDIYTRLLLAGRISLTIGLVSMLLSVTLG
YLLGALSGYLGGVVDKLIMRFADLLMTIPSLPLLIIMGAMLSELDVSPDYRIYMVMIMLS
LLGWPSLARLVRGQILSLRERDFMLATEVLGLSTRRRIFGHLLPNTIPILVVVATMGVAN
AILSESALSYLGLGVVPPMPSWGNMMDAANSLIDFQRRPWLWMPPGLAIFITVVAINILG
DGLRDALDPKMNGVRR