Protein Info for IAI46_15360 in Serratia liquefaciens MT49

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 119.4 bits, see alignment E=3.9e-38 PF17912: OB_MalK" amino acids 236 to 290 (55 residues), 35.7 bits, see alignment 2.6e-12 PF08402: TOBE_2" amino acids 285 to 356 (72 residues), 31.5 bits, see alignment E=3.2e-11

Best Hits

Swiss-Prot: 51% identical to UGPC_PARXL: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: None (inferred from 90% identity to spe:Spro_2849)

Predicted SEED Role

"Multiple sugar ABC transporter, ATP-binding protein" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>IAI46_15360 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Serratia liquefaciens MT49)
MAYVELVDINKRYDNGYQAASDVNLQVEKGEFVVLLGPSGCGKSTTLRMIAGLETLSSGE
LLIDGERMNEVLPKYRDIAMVFQSYALYPHMTVYENMALSLKIKGMAKAEIATQIAAVAE
MLHLTEFLKVKPGQLSGGQRQRVALGRAIVRRPKVFLFDEPLSNLDAKLRNRMRQELSAL
HKAIGATIIYVTHDQVEAMTMADKVVIMNQGKVQQIGTPLDLYHRPVNRFVAEFIGSPQM
NLFDVQVLVQGEQIVLQGDSGLLLPLSAAQFPALAAKGGDWLTLGCRPEACSISAPRAEP
HLSGTLVYSENLGAESNLFVQGDNGAQYIVKQHAQLQYAQGQPLAITLDITALHFFDPHS
GQRVAQSGETVLPAGIL