Protein Info for IAI46_15350 in Serratia liquefaciens MT49

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 272 (180 residues), 53.3 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 98% identity to spe:Spro_2847)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>IAI46_15350 carbohydrate ABC transporter permease (Serratia liquefaciens MT49)
MIAEGRRFDTGKLVIYLLVSLFASLSLFPFYWSALLATQDTRSIMGMSLRFGSHLLENYR
GLEQQVPFTRSLLNTLYVTAMATLTSVLVSAAAGYAFSVYQFKGKKVLFTTLMLTMMVPS
VVNLVPYFFVIKSVGLLDQFAAVWLPAGVNIFGIFLVRQYVSSSLPSEILDSARMDGLNE
LQIFLRIGLPLMRPALLTVAIVVVVDTWNNFMLPLVALQSPDKQILQLVLRSLSGATATP
WNLVMTGSFLAIVPLLIAFIFSSKQMMESLTRGAVKG