Protein Info for IAI46_15345 in Serratia liquefaciens MT49

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 301 (207 residues), 44.1 bits, see alignment E=9.9e-16

Best Hits

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 97% identity to spe:Spro_2846)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>IAI46_15345 sugar ABC transporter permease (Serratia liquefaciens MT49)
MRKRFFKGLLHDHRTAYLLLLPFMLLFAVFNAFPIFFSEFLSFQSWNPVKGLSSMKFVGL
DNFYYAFTDDAFWVSLVNTIKITLVSGLCQHLFAITLAYSLLHIIVRGRRFLKAAIFLPY
ITSSVAVSLIVFNLFSPVGMVNELLSGLAAKLHLSALAAALPINFFDSDWIRFTIANQVT
WKFTGINTVIYMTGLASISPDLYEAIELDGAGRWQKFRYIALPLLAPFIFFATLMTLIGN
MQLFNEPMILTQGTGGVDNSGLTVSMYVYKTGWSYLDMGTASAISWILFLLIALVSALVF
WGFGNRGGLKNDR