Protein Info for IAI46_15240 in Serratia liquefaciens MT49

Annotation: single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00621: single-stranded DNA-binding protein
  • amino acids 3 to 156 (154 residues), 183 bits, E=2.7e-58
• PF00436: SSB
  • amino acids 6 to 105 (100 residues), 132.8 bits, E=2.4e-43

Best Hits

Swiss-Prot: 63% identical to SSB_VIBPA: Single-stranded DNA-binding protein (ssb) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 68% identity to sbc:SbBS512_E4573)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Protein Sequence (156 amino acids)

>IAI46_15240 single-stranded DNA-binding protein (Serratia liquefaciens MT49)
MASKGVNKVILVGNLGKDPEVRYLPNGGAVANITLVTSESWRDKATGEQKEKTEWHRVVL
FGKLAEIAGEYLRKGSQVYIEGKLTTRKWVDQAGVEKYTTEIHVNVGGVLQMLGGRQGDG
APQQSGKQQRAVPAQGTNNNSEPPMDFDDYDSDIPF