Protein Info for IAI46_15105 in Serratia liquefaciens MT49

Annotation: phage holin, lambda family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 77 to 92 (16 residues), see Phobius details TIGR01594: phage holin, lambda family" amino acids 2 to 106 (105 residues), 99.2 bits, see alignment E=7.4e-33 PF05106: Phage_holin_3_1" amino acids 5 to 102 (98 residues), 99.3 bits, see alignment E=7.3e-33

Best Hits

KEGG orthology group: None (inferred from 50% identity to xbo:XBJ1_2034)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>IAI46_15105 phage holin, lambda family (Serratia liquefaciens MT49)
MKMKDNPDLWPGIWAALKAIWPAVGGSLIAGAVCYARLIHDGVHRKNKWIECVLCGLLAF
CVYKGAAILNLPEGSDVFIGGAIGFIGVEKVREYALRFMNKKTGIDGEKND