Protein Info for IAI46_14865 in Serratia liquefaciens MT49

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 449 (432 residues), 439.5 bits, see alignment E=1.5e-135 PF13520: AA_permease_2" amino acids 22 to 439 (418 residues), 130 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 71% identical to AROP_ECOL6: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to spe:Spro_2825)

MetaCyc: 71% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>IAI46_14865 amino acid permease (Serratia liquefaciens MT49)
MGGQQQDTPLKRGLKNRHIQLIALGGAIGTGLFLGIAQTIKMAGPSVLLGYAIGGFIAFL
IMRQLGEMVVEEPVAGSFSHFAYKYWGDFAGFLSGWNYWAMFILVGMAELTAVGIYIQYW
WPDIPTWVSAAVFFVLINLINLVNVRLYGETEFWFAIIKVVAIVGMILFGAWLLASGNGG
PQASLNNLWEQGGFMPHGISGLVMAMAVIMFSFGGLEMVGITAAEAADPRRSIPKATNQV
VYRILIFYIGSLTVLLSLYPWDKVVEGGSPFVMIFHALDSSLVATLLNVVVLTAALSVYN
SGVYANSRMLFGLATQGNAPKALTRVNKRGVPVLSIALSALVTSVGVLINYVMPGKAFEL
LMALVVSTLVINWVMICLAHLRFRAAKNRQGVIPSFKALWYPFGNYLCLVFLSLILVIMY
FSEGIRISVLLMPVWILLLWVGFRLTRRKGANVRR