Protein Info for IAI46_14765 in Serratia liquefaciens MT49

Annotation: ATP-dependent RNA helicase DbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF04851: ResIII" amino acids 26 to 188 (163 residues), 37.3 bits, see alignment E=5.5e-13 PF00270: DEAD" amino acids 28 to 194 (167 residues), 163.8 bits, see alignment E=6.1e-52 PF00271: Helicase_C" amino acids 232 to 337 (106 residues), 103.6 bits, see alignment E=1.4e-33 PF03880: DbpA" amino acids 387 to 457 (71 residues), 83.9 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 98% identity to spe:Spro_2804)

Predicted SEED Role

"ATP-dependent 23S rRNA helicase DbpA"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>IAI46_14765 ATP-dependent RNA helicase DbpA (Serratia liquefaciens MT49)
MSTVSFSSLPLPAEQLANLNELGYAEMTPVQAAALPAILKGQDVRAKAKTGSGKTAAFGI
GLLDKINVSQVAAQALILCPTRELADQVSKELRRLARFTQNIKILTLCGGQPMGPQLDSL
VHAPHIVVGTPGRIQEHLRKKTLVLDELKVLVLDEADRMLDMGFADDIDDVISYTPPQRQ
TLLFSATYPSGIERISARVQREPLNVEVDDGEEQTTIEQRFYETTRDQRPAVLVSAIRHY
QPSSCVVFCNTKRDCQSVYEALEARGINVLALHGDLEQRDRDQVLVRFANRSCRVLVATD
VAARGLDIKELELVVNYELAFDPEVHVHRIGRTGRAGLSGLAISLCTPQEMTRAHAIEEY
LQIRVNWAPVSELSGAGNTTLEAEMVTLCIDGGRKAKIRPGDILGALTGEAGLTAAEVGK
IDMFPVHAYVAIRKASARKALQQLQQGKIKGKNCKVRLLK