Protein Info for IAI46_14740 in Serratia liquefaciens MT49

Annotation: phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 491 to 513 (23 residues), see Phobius details amino acids 519 to 542 (24 residues), see Phobius details PF03109: ABC1" amino acids 94 to 338 (245 residues), 238.2 bits, see alignment E=7.6e-75 PF01636: APH" amino acids 144 to 311 (168 residues), 27.6 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 92% identity to spe:Spro_2799)

Predicted SEED Role

"ABC1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>IAI46_14740 phosphotransferase (Serratia liquefaciens MT49)
MLKMVLVTARDRARLKEISTVLIRYGLQDVIRLLGLSNLLSGAEGSSERQDGQTLPQRLR
AALEALGPTFVKFGQILATRSDLLDASWTDELDRLHSQASTLSWEQLAPQIRADLKGDPH
SLFAEFDESPLAAASMAQIYRARLHSGEAVVIKVLRPGLAKTIQADLRLLTYLAETVEQQ
SPALARYRPRQMVRALATALTHELDLTHEGNNCERVAQQFAQQPNVVIPKIYWQWSSQRL
LVQEFLPGIAPENPQQLAAAGLDGPLLAQRGAQAFMKMVLEHRLYHADPHPGNVMALADN
RVGFIDFGMVGQLSERRRNQLLLLLQAIVERESAGIVNTLIAWSDSDPLDLLDLELAAQN
FLDKQASATLTLGKALTDLLVMVREHQLALPPDLVLLFKALITADGVLHRLDPHFDIIAT
LKPMLKQVMLQRYTPEAVQRRMLALGGEALDASEELPQTLRLLMRRLKGGKISADINVKN
IDQLSKALERAAITLAIAIVTAAFALGLAPYLMHSSLRLWGIPLFPALGALACLGGVLLL
VLRLRR