Protein Info for IAI46_14725 in Serratia liquefaciens MT49

Annotation: multidrug efflux MFS transporter MdtH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 78 to 94 (17 residues), see Phobius details amino acids 100 to 116 (17 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 310 (291 residues), 107.3 bits, see alignment E=4.1e-35 amino acids 210 to 390 (181 residues), 44.1 bits, see alignment E=6.6e-16

Best Hits

Swiss-Prot: 96% identical to MDTH_SERP5: Multidrug resistance protein MdtH (mdtH) from Serratia proteamaculans (strain 568)

KEGG orthology group: K08162, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 96% identity to spe:Spro_2796)

Predicted SEED Role

"MFS superfamily export protein YceL" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>IAI46_14725 multidrug efflux MFS transporter MdtH (Serratia liquefaciens MT49)
MSLVSQARSLGKYFLLLDNLLVVLGFFVVFPLISIRFVDQLGWAAVVVGAALGLRQLIQQ
GLGIFGGAIADRFGAKPMIVTGMLMRAAGFATMAMADQPWILWFSCALSALGGTLFDPPR
TALVIKLTRPHERGRFYSLLMMQDSAGAVIGALIGSWLLQYDFHFVCWVGAGIFVLAAGW
NAWLLPAYRISTVRAPMKEGMMRVLRDRRFLTYVLTLTGYYMLSVQVMLMLPIVVNEIAG
SPTAVKWMYAIEAALSLSLLYPIARWSEKRFRLEQRLMAGLLLMTLSLIPVGLATSLQGV
FTLICCFYLGSIIAEPARETLSASLADPRARGSYMGFSRLGLALGGAVGYTGGGWMYDTG
HAVGMPELPWILLGIVGLITLFALYWQFNPRSIASEALPGG