Protein Info for IAI46_14675 in Serratia liquefaciens MT49

Annotation: tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00452: tRNA (mo5U34)-methyltransferase" amino acids 7 to 321 (315 residues), 482.3 bits, see alignment E=2.5e-149 PF08003: Methyltransf_9" amino acids 7 to 322 (316 residues), 553.1 bits, see alignment E=4.1e-170 PF13489: Methyltransf_23" amino acids 113 to 270 (158 residues), 39.1 bits, see alignment E=1.6e-13 PF13847: Methyltransf_31" amino acids 123 to 228 (106 residues), 30.4 bits, see alignment E=7.9e-11 PF13649: Methyltransf_25" amino acids 126 to 204 (79 residues), 28.2 bits, see alignment E=6.5e-10 PF08241: Methyltransf_11" amino acids 127 to 223 (97 residues), 25.5 bits, see alignment E=4.4e-09

Best Hits

Swiss-Prot: 96% identical to CMOB_SERP5: tRNA U34 carboxymethyltransferase (cmoB) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_2880)

MetaCyc: 78% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>IAI46_14675 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB (Serratia liquefaciens MT49)
MIEFGDFYQRIAKSNLSHWLDTLPAQLSAWQRESLHGKFKQWFNSVEHLPALTPTQLDLL
HGVRAEMEPPLSPGQLEGIEKMLRTMMPWRKGPFSLYGIDIDTEWHSDWKWDRVLPHISP
LAGRTILDVGCGSGYHLWRMVGAGAHLAVGIDPMQLFLCQFEAVRKLLGGDQRAHLLPLG
IEQLPELAAFDTVFSMGVLYHRRSPLDHLYQLKNQLVSEGELVLETLVVEGDRHQVLVPG
DRYAQMRNVYFIPSAEALKFWLEKCGFVDVKIADMCVTSTEEQRRTDWMTSESLAEFLDP
QDPSKTVEGYPAPLRAVLVARKP