Protein Info for IAI46_14590 in Serratia liquefaciens MT49

Annotation: leucine-rich repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF13855: LRR_8" amino acids 58 to 113 (56 residues), 29 bits, see alignment E=1.1e-10 amino acids 102 to 160 (59 residues), 30.4 bits, see alignment E=4.1e-11 amino acids 126 to 183 (58 residues), 33.3 bits, see alignment E=4.8e-12 amino acids 172 to 229 (58 residues), 41.2 bits, see alignment E=1.8e-14 amino acids 227 to 275 (49 residues), 32.8 bits, see alignment 7e-12 PF00560: LRR_1" amino acids 58 to 76 (19 residues), 11 bits, see alignment (E = 6.7e-05) amino acids 150 to 170 (21 residues), 11.4 bits, see alignment (E = 4.9e-05) amino acids 218 to 239 (22 residues), 11.9 bits, see alignment (E = 3.4e-05) PF12799: LRR_4" amino acids 150 to 186 (37 residues), 31.3 bits, see alignment 2.8e-11

Best Hits

KEGG orthology group: None (inferred from 76% identity to srs:SerAS12_2864)

Predicted SEED Role

"FIG01056060: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>IAI46_14590 leucine-rich repeat domain-containing protein (Serratia liquefaciens MT49)
MLHQHPQQNRTAQSLDLDGQGLENLDDTCLQGNSLLKISLYNNRLRQFPRQILQHADLQV
LNISCNQLSELPTEIGLLIQLAMLDCGHNQANQIPAGIGELRELTYLYLSDNAFRDLPLE
LGRLHKLRYLNATDNQLSELPTAIVQLGALQELRLYNNQIASLPETFGQLTALRELHLMN
NRLVALPEQIAQLSALRVLDVENNAISQLPTTLGRLANLTHLNLRTNRLQQLPTSFGQLK
ALTTLDLRANRLSALPDSLAELTQLQRLDLRWNNFAEMPAVLEPLIAQGCLVHI