Protein Info for IAI46_14560 in Serratia liquefaciens MT49

Annotation: multidrug/spermidine efflux SMR transporter subunit MdtI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 10 to 99 (90 residues), 96 bits, see alignment E=7.7e-32

Best Hits

Swiss-Prot: 97% identical to MDTI_SERP5: Spermidine export protein MdtI (mdtI) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_2857)

MetaCyc: 79% identical to multidrug/spermidine efflux pump membrane subunit MdtI (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266

Predicted SEED Role

"Spermidine export protein MdtI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>IAI46_14560 multidrug/spermidine efflux SMR transporter subunit MdtI (Serratia liquefaciens MT49)
MQQLELYHIGFLGLAIVLEIVANIFLKMSDGFRKIWLGLLSLLSVLGAFSALAQAVKGID
LSVAYALWGGFGIAATIAAGWILFGQRLNAKGWIGLVLLLAGMVIIKLA