Protein Info for IAI46_14480 in Serratia liquefaciens MT49

Annotation: sodium/proton antiporter NhaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 44 to 77 (34 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 129 to 166 (38 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details amino acids 481 to 502 (22 residues), see Phobius details PF06450: NhaB" amino acids 1 to 513 (513 residues), 924.6 bits, see alignment E=1.9e-282 TIGR00774: Na+/H+ antiporter NhaB" amino acids 1 to 513 (513 residues), 923 bits, see alignment E=3.1e-282 PF03600: CitMHS" amino acids 71 to 346 (276 residues), 68.3 bits, see alignment E=6.9e-23

Best Hits

Swiss-Prot: 94% identical to NHAB_SERP5: Na(+)/H(+) antiporter NhaB (nhaB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03314, Na+:H+ antiporter, NhaB family (inferred from 94% identity to spe:Spro_2749)

MetaCyc: 77% identical to Na+:H+ antiporter NhaB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-130

Predicted SEED Role

"Na+/H+ antiporter NhaB" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (523 amino acids)

>IAI46_14480 sodium/proton antiporter NhaB (Serratia liquefaciens MT49)
METTLRSALVKNFLGQSPDWYKLAILIFLLVNPLVFFLVDPFIAGWLLVIEFIFTLAMAL
KCYPLLPGGLLAIEAVLIGMTSPDRVGEEIAHNLEVLLLLIFMVAGIYFMKQLLLFVFTK
LLLNIRSKILLSLAFCFAAAFLSAFLDALTVVAVVISVATGFYSIYHNVVSNPSGGAADV
NDDSNLVSDDNKQTLEQFRAFLRSLLMHAGVGTALGGVMTMVGEPQNLIIAKSADWGFVD
FFLRMAPVTLPVLICGLLVCLLLERFGVFGYGAKLPERVREVLTEFDRQATAGRSKQEQV
KLVVQALIGVWLIVALAFHLAEVGLIGLSVIILATSLCGVTDEHAIGKAFQEALPFTALL
TVFFTVVAVIIEQHLFTPVIQFVLQAEPSSQLSLFYLFNGLLSSVSDNVFVGTVYINEAR
AAFENGAISLKQFEMLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLVRLSYGRMVWM
ALPYTVVLTLVGLLCVQFTLAPVTDLLTQWHWLTLPSLEAAAH