Protein Info for IAI46_14450 in Serratia liquefaciens MT49

Annotation: multidrug effflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details amino acids 366 to 382 (17 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 3 to 374 (372 residues), 242.3 bits, see alignment E=5.8e-76 PF07690: MFS_1" amino acids 10 to 351 (342 residues), 149.2 bits, see alignment E=1.5e-47 PF00083: Sugar_tr" amino acids 37 to 180 (144 residues), 31 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 96% identity to spe:Spro_2744)

Predicted SEED Role

"Putative multidrug resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>IAI46_14450 multidrug effflux MFS transporter (Serratia liquefaciens MT49)
MQKFLFLLLSLVLLGPLGIDLYLPTIPAIALGLNSSEALIQSTISLFILVLGLGQIIAGP
LVDNYGRKPVALAGIIIYMIGAAMAALATTPTVFVASRLLQGVAVCCTAVVAFSGVRDRM
NGDDAARAFGFLNGTLNIIPALAPLLGGLLAEALGWRAPFWFLVCYALAVLVLIALRLPE
TRPADTVRVKGLPVRQYARILKDRRFLSFAVVNSGAMGMALTYVSLAPNVLMGTAGLTPL
QFSLVFGANGFWIMLVSFFANRIIHKVGRPVCLATGGILMGIGCVGLLLGVTWLSGSAQT
HWLAYMLPVASACAGLAFVMGPATSYALEPYSNEAGVASALVGFVQMAGGAGLGLLAMAL
PLQPKLSLALVMLVGCLLALHARQRSKQIKGQLKKIA