Protein Info for IAI46_14380 in Serratia liquefaciens MT49

Annotation: YeaH/YhbH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF04285: DUF444" amino acids 4 to 420 (417 residues), 630.8 bits, see alignment E=6.5e-194

Best Hits

Swiss-Prot: 99% identical to Y2732_SERP5: UPF0229 protein Spro_2732 (Spro_2732) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09786, hypothetical protein (inferred from 99% identity to spe:Spro_2732)

Predicted SEED Role

"UPF0229 protein YeaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>IAI46_14380 YeaH/YhbH family protein (Serratia liquefaciens MT49)
MAYFIDRRLNGKNKSMVNRQRFLRRYKSQIKQSIAEAINKRSVTDVDSGESVSIPAGDIN
EPMFHQGRGGTRHRVHPGNDHFVQNDRVERPQGGGGGGGGQGNASQDGEGEDEFVFQISK
DEYLDLLFEDLALPNLKKNQYKQLTEYKTHRAGYTANGVPANISVVRSLQNSLARRTAMT
AGKRRALHELEDELTQMENTEPVQLLEEERLRKEIAELRKKIESVPFIDTFDLRYKNYER
RPEPSSQAVMFCLMDVSGSMDQATKDMAKRFYILLYLFLSRTYKNVEVVYIRHHTQAKEV
DEQEFFYSQETGGTIVSSALKLMNEVVEERYDPAQWNIYAAQASDGDNWADDSPLCHELL
AKKLLPMVRYYSYIEITRRAHQTLWREYEDLQAKFENFAMQHIREPDDIYPVFRELFHKQ
TV