Protein Info for IAI46_14255 in Serratia liquefaciens MT49

Annotation: patatin-like phospholipase RssA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01734: Patatin" amino acids 8 to 165 (158 residues), 111.1 bits, see alignment E=4e-36

Best Hits

Swiss-Prot: 72% identical to RSSA_ECOLI: NTE family protein RssA (rssA) from Escherichia coli (strain K12)

KEGG orthology group: K07001, (no description) (inferred from 95% identity to srs:SerAS12_2743)

Predicted SEED Role

"UPF0028 protein YchK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>IAI46_14255 patatin-like phospholipase RssA (Serratia liquefaciens MT49)
MRKIKIGLALGAGSAKGWAHIGVINALKKLGVEVDIVAGCSVGALVGAAFASHRLPAMET
WVRSFSYWDVIRLMDLSWQRGGLLRGERVFNAVGQLLKIDDIAECSLKFGAVATNLSTGR
ELWLTEGDIHQAVRASCSMPGLLAPVWFDGYWLVDGAVVNPVPISLTRALGADIVIAVDL
QHDAHLMQQDLFSVRNHDVEAPQDLPARNWRGRLRERISKMTARKPNFTPTAMEIMGTSI
QVLENRLKRNRMAGDPPDVLIQPYCPQISTLDFHRADEAIAAGKLAVEKQIDMLLPLIKN
K