Protein Info for IAI46_14100 in Serratia liquefaciens MT49

Annotation: MFS transporter TsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 335 to 359 (25 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 319 (309 residues), 81.2 bits, see alignment E=3.6e-27

Best Hits

KEGG orthology group: None (inferred from 86% identity to spe:Spro_2681)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>IAI46_14100 MFS transporter TsgA (Serratia liquefaciens MT49)
MSSYQASLLSVSFMTYMVMAGLLTQIGIVIKPMSVYLGMGITDAAAMFSYLTGGTLLGTF
ISMAVYSRFEIRHILRVTYAIFLVVLAALVFLDVRNPFVVSFYLFVLGTCCGTGLSGGAV
LISKVFNENKRASAFIATDCAFSASGFIFPSMATMIIAANMQWTTAYGLAGVIAALVFIS
TFILKYPKGDLAEADKANTPGARFNWKEVMTPRVVLMGFALGVYLFAQSTFLTWSPSYLQ
QTFGLSAAESGAAVGNYWGPSVFGLITAAILVNKIPARVMLVAVSIIAILVTFYLSITHN
PRVFLTLTLGFGFLTSCVYKLGISVGSQQVKNSPAVLVTFLLTCGTVGSTISPALSAAIV
DRFGVASAMVMTVLGFTAVCIAIVACLILEMIENTKSTKEIYS