Protein Info for IAI46_14085 in Serratia liquefaciens MT49

Annotation: acyl-CoA thioester hydrolase YciA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 26 to 98 (73 residues), 74 bits, E=5.1e-25

Best Hits

Swiss-Prot: 78% identical to YCIA_ECOLI: Acyl-CoA thioester hydrolase YciA (yciA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_2673)

MetaCyc: 78% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase YciA, involved in membrane biogenesis"

MetaCyc Pathways

• acyl-CoA hydrolysis (1/1 steps found)
• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (4/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.20

Protein Sequence (142 amino acids)

>IAI46_14085 acyl-CoA thioester hydrolase YciA (Serratia liquefaciens MT49)
MTQQRPLPSGEMVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAEGRVVTVRVD
GMTFLKPVAVGDVVCCYAHCIRTGRSSITINIEVWVKKVSSAPIGQRYRATEAVFTYVAV
DDEGNSRALPDGKMNFRVGFDE