Protein Info for IAI46_14075 in Serratia liquefaciens MT49

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 387 to 413 (27 residues), see Phobius details PF00916: Sulfate_transp" amino acids 24 to 382 (359 residues), 279.3 bits, see alignment E=4.2e-87 PF01740: STAS" amino acids 447 to 532 (86 residues), 41.1 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_2671)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>IAI46_14075 SulP family inorganic anion transporter (Serratia liquefaciens MT49)
MQWKSLQALTPGLTHLLGYQRSWLKPDIRAGLSVAAVALPVAIAYAELAGVSPVVGLYSC
ILPMVAYAFFGSSRQLIVGPDAATCAVIAAVVTPLAAGNMERHWQLTIMMTAMMGAWCLL
ASRFKLGALADLLSRPILSGLLNGVAITIMVDQIGKVLGFGMHPAQLIERIYALPGNLMH
SDVLTMAVSLLTLVTLVGFKKWRPNWPAPLFAIVLAAFVTWAGGLQQHGVVTVGGFSDVL
PIVQWPDFQPGLLRDMVIPALNLAVVSFVSMMLTARSFAAKNGYEVNADAEFRALGLVNI
VSALSQGFAISGADSRTAVNDANGGKSQLVSIIAAGVIAFVLLFLMAPLQFIPVAGLGVV
LMYAAWSLLDIRSIWIMRRRNAQAFRLAMFTFLCVLLVGVISGIGLAVLLGLMQFLRTVF
RPTEQLLGVNDEGMIHSMGNNNGIKPVPGVMMYRFNSPLTYFNVAYFKRRILNLVDSTPF
QPRWVVVDAVASFTHADISVLAAIDELKRDLLQRNVKLVLAGRRTELTRWFRINRVGRDR
ELILVPDLYLALKLIQSKEQAEPAVAP