Protein Info for IAI46_13915 in Serratia liquefaciens MT49

Annotation: orotidine-5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00215: OMPdecase
  • amino acids 16 to 237 (222 residues), 234 bits, E=1e-73
• TIGR01740: orotidine 5'-phosphate decarboxylase
  • amino acids 18 to 238 (221 residues), 185.3 bits, E=6.2e-59

Best Hits

Swiss-Prot: 81% identical to PYRF_YERPY: Orotidine 5'-phosphate decarboxylase (pyrF) from Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 97% identity to spe:Spro_2647)

MetaCyc: 77% identical to orotidine-5'-phosphate decarboxylase (Escherichia coli K-12 substr. MG1655)
Orotidine-5'-phosphate decarboxylase. [EC: 4.1.1.23]

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Protein Sequence (242 amino acids)

>IAI46_13915 orotidine-5'-phosphate decarboxylase (Serratia liquefaciens MT49)
MKSENNINNNDLKSSPIIVALDYADIGAALAFADRIDPQDCRLKVGKEMFTLFGPQLVRD
LHSRGFDVFLDLKFHDIPNTTARAVAAAAELGVWMVNVHASGGARMMTAAKEALQPYGAQ
APLLIAVTVLTSMEAEDLRGIGIELSPAEHAERLARLTRDCGLDGVVCSAHEAERLKAAC
GQQFQLVTPGIRPEGSDAGDQRRIMTPVQAQAAGVDYMVIGRPITQSADPAATLSAIRAS
LA