Protein Info for IAI46_13885 in Serratia liquefaciens MT49

Annotation: glycyl-radical enzyme activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 2 to 291 (290 residues), 337.8 bits, E=2.7e-105
• PF13353: Fer4_12
  • amino acids 12 to 155 (144 residues), 37.3 bits, E=3.4e-13
• PF04055: Radical_SAM
  • amino acids 20 to 228 (209 residues), 38.6 bits, E=1.3e-13

Best Hits

Swiss-Prot: 66% identical to PFLE_ECOLI: Putative pyruvate formate-lyase 3-activating enzyme (ybiY) from Escherichia coli (strain K12)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 89% identity to spe:Spro_2641)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Protein Sequence (299 amino acids)

>IAI46_13885 glycyl-radical enzyme activating protein (Serratia liquefaciens MT49)
MIFNLQRYSTHDGPGIRSVVFLKGCSLGCLWCQNPESRSRKADLLFDPRLCLSGCTLCAE
GHPQAIQRIDDNLLIQRELLSHEEYAALAARCPTDALSLCGSAVNIDDIMTEVLRDRPFY
LRTGGGLTLSGGEPFMQPAVAAELLKRGREAGIHTAVESCLHTPWSHIAPSLPWLDLMLA
DLKHVDEKRFKQWTGGSAKRVMENFRRLAAHGTRMTVRVPLIPDFNADRRSIRAIVDFAA
DEAGVTEIHFLPYHTLGINKYNLLGEPYHAARTPLDAPELLAYAEQYTEAKGLTAILRG