Protein Info for IAI46_13545 in Serratia liquefaciens MT49

Annotation: peptide ABC transporter ATP-binding protein SapF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 29 to 178 (150 residues), 119.1 bits, E=2.4e-38

Best Hits

Swiss-Prot: 82% identical to SAPF_SALTY: Peptide transport system ATP-binding protein SapF (sapF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 98% identity to spe:Spro_2633)

MetaCyc: 82% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Protein Sequence (270 amino acids)

>IAI46_13545 peptide ABC transporter ATP-binding protein SapF (Serratia liquefaciens MT49)
METLLEVRNLSKTYRYRTGLFRRQHVEAVKSVSFTLRERQTLAIIGENGSGKSTLAKMLS
GMVEPSAGELLIDDHRLNYGDYRYRSQRIRMIFQDPSTSLNPRQRIGQLLDAPLRLNTEM
AAPEREQQINRTLRQVGMLPDHANYYPHMLASGQKQRVALARALILQPKVIVADEALASL
DMSMRSQIINLMLELQEKHGISYIYVTQHLGMMKHISDQVMVMHEGEIVERGSTAEVLAS
PLHELTKRLIASHFGEALTADAWRRDGGRF