Protein Info for IAI46_13515 in Serratia liquefaciens MT49

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_2627)

Predicted SEED Role

"Carbonic anhydrase, gamma class (EC 4.2.1.1)" (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (186 amino acids)

>IAI46_13515 carbonate dehydratase (Serratia liquefaciens MT49)
MLRKNPSGHLPQVSPQAYIDPTAIICGRVIIEEFVYVGPYAVIRADELNAAGDMEPIVIG
SHSNIQDGVVIHSKSGAAVTIGRFSSIAHRAIVHGPCCIEDRVFIGFNSVLFNCHIGSGC
VVRYNAVVDGVTLPQNLYIPSTERVGADSDLSLYRQVDRGALQFSEEVAATNVELVRGYQ
ALRNEF